NOTE: This product has been discontinued by the manufacturer. For alternative products, please see our other Attachment Factors. Description Human Vitronectin Recombinant Protein, manufactured in the United Kingdom by Multus Biotechnology Limited, is an E. coli-expressed truncated version of the wild-type human vitronectin (VTN-N) fused with a 6-histadine tag. ISO22000 certified Supports cell adhesion and proliferation Animal-free Summary A critical challenge in the cell culture industry is the cost of growth media. Current solutions are not designed for the food industry. Fetal bovine serum (FBS) is often used in cell culture but may be unethically sourced and has large price and performance fluctuations. Serum-free formulations are typically expensive, do not always perform well across the range of cell lines used in cultivated meat, and are not designed for scale. Multus creates the key ingredients for companies to accelerate R&D and scale production to bring cultivated meat to market affordably and profitably. One of the key ingredients commonly used in both the biopharmaceutical and cellular agriculture industries is Vitronectin. Multus produces recombinant human Vitronectin which can be used as an extracellular matrix (ECM) to promote cell proliferation and supports normal colony morphology for different cell types. Specifications Test Specification Concentration 150-250 μg/ml (for exact concentration see bottle label) Bacteria Testing Negative Mycoplasma Testing Negative Fungal Testing Negative Particulate Examination Negative Endotoxin < 2 EU/μg Filtered 0.2 μm Cell Growth Pass Figure 1: SDS Page and Western Blot showing the purified vitronectin. Coating Performance Comparison Figure 2: Cell growth in serum-free media. Figure 3: Cell attachment in DMEM only. Application Notes Adapt cells to the growth media of choice for at least 48 hours before starting the experiment. Thaw Vitronectin overnight at 4°C. For coating, dilute Vitronectin into PBS1X at a final concentration of 10 μg/ml. To coat the surface, transfer 156.25 μl/cm2 of the Vitronectin solution to the center of area (e.g., for a 96-well plate, 0.32 cm2, add 50 μl) and rock the plate/dish gently horizontally, side to side and forward-backward to spread the coating solution across the entire well surface. Incubate the plates for 1 hour at 37°C in a humidified CO2 incubator. Remove Vitronectin solution from the wells and quickly rinse once with 100 μl/well of PBS1X. After coating, add 255 μl/well of serum free medium without allowing the wells to dehydrate. Seed cells at a density of 5,000 cells/well in serum free media and grow cells at 37°C in a humidified CO2 incubator. For serum-free growth media, we recommend 10% Proliferum® LSR in DMEM/F12. Amino Acid Sequence MDQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGE EKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQ PPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQ GKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWE YQFQHQPSQEECEGSSSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQ VDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRHHHHHH Storage Upon arrival, store the product below -70°C. Upon first thawing, aliquot it to avoid damage via repeated freeze-thaw cycle. Before use, thaw vitronectin overnight at 4°C, then freeze it immediately after use. Usage/Safety This product is intended for Laboratory Research Use Only. Not for use in diagnostic or therapeutic procedures. This product may not be used as a pharmaceutical or veterinary drug, agricultural product, or food additive. Rigorous quality control ensures maximum sterility and minimum endotoxin levels. Risk of contamination from viruses and immunogens are avoided by design.Produced under ISO22000 food safe manufacturing standard. Multus is working towards establishing a complete safety profile for using this product in food production. The use of this item is subject to Multus Biotechnology Limited’s Terms and Conditions of Use. Synonyms rh-Vitronectin, VN, VTN, S-protein, Serum-spreading factor, V75 Background Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interacts with glycosaminoglycans and proteoglycans. It is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway (UniProt KB# P04004). Resources Product Datasheet (PDS) RELATED PRODUCTS Attachment Factors Extracellular Matrix Molecules DMEM/F12 Culture Media Ilex Life Sciences LLC is an official distributor of Multus Biotechnology Limited.