Recombinant Enterococcus faecalis UPF0316 protein EF_1609(EF_1609)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Enterococcus faecalis (strain ATCC 700802 / V583)Uniprot NO.:Q834N5Tag Info:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MVVDLKMLAMIFIINFAYITLNTIRFMLTMKGYRVIAPLVSMAEITIYVLGLSMVLNRLD NPLNLLVYALGYAVGISVGIKIEDYLALGYIMVSVILPSTTEQFHLPETLREHGYGVTQS VAYGREGERMVLEILSPRKNERTLYKLINQLEPRAFIISYEPKFISGGFWTKKVRKRNDA ISHProtein Names:Recommended name: UPF0316 protein EF_1609Gene Names:Ordered Locus Names:EF_1609Expression Region:1-183Sequence Info:full length protein Show more