Recombinant GM-CSF, Mouse - BK0212

AFSBio Inc. Verified independent store

→

Recombinant GM-CSF, Mouse Catalogue Numbers: BK0212-10, BK0212-50 Sizes: 10μg, 50μg Source: CHO Molecular Weight: 15~19 kDa, observed by non-reducing SDS-PAGE. Purity: > 95% as ana lyzed by SDS-PAGE and HPLC. Biological Activity: ED50 < 0.05 ng/ml, measured in a cell proliferation assay using mouse FDC-P1 cells, corresponding to a specific activity of >2 x 10ˆ7 units/mg. Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Formulation: Lyophilized after extensive dialysis against PBS. AA Sequence: APTRSPIt VTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK Endotoxin: Show more