Size: 200ug. Other sizes are also available. Please Inquire.In Stock: YesLead time: 3-7 working daysResearch Topic: ImmunologyUniprot ID: P01732Gene Names: CD8AOrganism: Homo sapiens (Human)AA Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDExpression Region: 22-182aaSequence Info: Extracellular DomainSource: YeastTag Info: N-terminal 6xHis-taggedMW: 19.6 kDaAlternative Name(s): T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8aRelevance: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.Reference: "The isolation and sequence of the gene encoding T8: a molecule defining functional classes of T lymphocytes."Littman D.R., Thomas Y., Maddon P.J., Chess L., Axel R.Cell 40:237-246(1985)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Related
Related
Related