Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: OthersUniprot ID: P21844Gene Names: Cma1Organism: Mus musculus (Mouse)AA Sequence: IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILREExpression Region: 22-246aaSequence Info: PartialSource: E.coliTag Info: N-terminal 6xHis-taggedMW: 29.2 kDaAlternative Name(s): Alpha-chymase;Mast cell chymase 1Mast cell protease 5 ;mMCP-5Mast cell protease IRelevance: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion.Reference: Characterization of the gene encoding mouse mast cell protease 8 (mMCP-8),and a comparative analysis of hematopoietic serine protease genes.Lunderius C., Hellman L.Immunogenetics 53:225-232(2001) Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
