Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: Signal Transduction Uniprot ID: Q9ESG4Gene Names: Tmem27Organism: Mus musculus (Mouse)AA Sequence: ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVPExpression Region: 15-141aaSequence Info: Extracellular DomainSource: E.coliTag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedMW: 34.5 kDaAlternative Name(s): Transmembrane protein 27Relevance: Regulator of SNARE complex function. Stimulator of beta cell replication.Reference: "Collectrin, a collecting duct-specific transmembrane glycoprotein, is a novel homolog of ACE2 and is developmentally regulated in embryonic kidneys." Zhang H., Wada J., Hida K., Tsuchiyama Y., Hiragushi K., Shikata K., Wang H., Lin S., Kanwar Y.S., Makino H. J. Biol. Chem. 276:17132-17139(2001)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Related
Related