Recombinant Mouse Osteocalcin(Bglap)

GeneBio Verified independent store

→

Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: Signal TransductionUniprot ID: P86546Gene Names: BglapOrganism: Mus musculus (Mouse)AA Sequence: YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITIExpression Region: 50-95aaSequence Info: Full LengthSource: E.coliTag Info: N-terminal 6xHis-SUMO-taggedMW: 21.1 kDaAlternative Name(s): Bone Gla protein Short name: BGP Gamma-carboxyglutamic acid-containing proteinRelevance: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.Reference: "The mouse osteocalcin gene cluster contains three genes with two separate spatial and temporal patterns of expression."Desbois C., Hogue D.A., Karsenty G.J. Biol. Chem. 269:1183-1190(1994) Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. Show more