Size: 200ug. Other sizes are also available. Please Inquire.In Stock: YesLead time: 3-7 working daysResearch Topic: OthersUniprot ID: P04640Gene Names: BglapOrganism: Rattus norvegicus (Rat)AA Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTVExpression Region: 50-99aaSequence Info: Full LengthSource: E.coliTag Info: N-terminal GST-taggedMW: 32.6 kDaAlternative Name(s): Bone Gla protein ;BGPGamma-carboxyglutamic acid-containing proteinRelevance: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.Reference: Structure of the rat osteocalcin gene and regulation of vitamin D-dependent expression.Lian J., Stewart C., Puchacz E., Mackowiak S., Shalhoub V., Collart D., Zambetti G., Stein G.Proc. Natl. Acad. Sci. U.S.A. 86:1143-1147(1989) Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
