Recombinant Pasteurella multocida Uncharacterized protein PM1386(PM1386)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Pasteurella multocida (strain Pm70)Uniprot NO.:Q9CL57Tag Info:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:MAQGYAWFCCASNSSTRFSNATNFSRVRINTCVCTSNSSRVTKSSFANCACNVCLSLASA SCPKSLIPCGRESWICCITCSIFFGFSIIASYFLKFHLLYVILLQIKTFFRDProtein Names:Recommended name: Uncharacterized protein PM1386Gene Names:Ordered Locus Names:PM1386Expression Region:1-112Sequence Info:full length protein Show more