Size: 200ug. Other sizes are also available. Please Inquire.In Stock: NoLead time: 10-20 working daysResearch Topic: OthersUniprot ID: P01238Gene Names: PRLOrganism: Sus scrofa (Pig)AA Sequence: LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNCExpression Region: 31-229aaSequence Info: Full LengthSource: E.coliTag Info: N-terminal 6xHis-SUMO-taggedMW: 39 kDaAlternative Name(s): Relevance: Prolactin acts primarily on the mammary gland by promoting lactation.Reference: Nucleotide sequence of porcine preprolactin cDNA.Schulz Aellen M.F., Schmid E., Movva R.N.Nucleic Acids Res. 17:3295-3295(1989)Purity: Greater than 90% as determined by SDS-PAGE.Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
