Recombinant Uncharacterized protein ML2453(ML2453)

GeneBio Verified independent store

→

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Mycobacterium lepraeUniprot NO.:Q9CB43Tag Info:The tag type will be determined d uring production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:ALQRPDAYTAAEKLTKPVWLVILGAAVSLTSILGFVFGVLGIVIAACAAGVYLVDVRPKL LDIQGKSRProtein Names:Recommended name: Uncharacterized protein ML2453Gene Names:Ordered Locus Names:ML2453Expression Region:20-87Sequence Info:full length protein Show more