HiActi™ Recombinant Porcine IL-1 alpha Protein, His Tag _ 90301ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

Interleukin-1α (IL-1α), also known as hematopoietin-1, is a cytokine with a molecular weight of 17.65 kDa, comprising 159 amino acid residues. IL-1α is primarily expressed in macro phages, neutrophils, epithelial cells, and endothelial cells. Upon binding to the IL-1 receptor, it mediates various biological processes, such as cell proliferation, angiogenesis, interleukin-2 production, and cellular sodium homeostasis. Furthermore, IL-1α plays a critical role in immune responses, including fever and inflammation, and induces tumor necrosis factor-α (TNF-α). Specifications Cat.No. 90301ES08 / 90301ES20 Size 5 μg / 20 μg Components Name 90301ES08 90301ES20 HiActi™ Recombinant Porcine IL-1 alpha Protein, His Tag 5 μg 20 μg Performance parameters Synonyms interleukin 1 alpha, IL1A Species Porcine Expression Sequence MSATYSFQSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS with polyhistidine tag at the C-terminus. Accession P18430 Tag C-His Expression System E.coli Molecular Weight The protein has a calculated MW of 19.02 kDa. The protein migrates as 17-25 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more