HiActi™ Recombinant Porcine IL-8 Protein, His Tag _ 90304ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

This recombinant protein is the major form secreted by macrophages. IL-8 is a chemokine produced by macrophages and other cell types, such as epithelial cells, airway smooth muscle cells, and endothelial cells. Specifications Cat.No. 90304ES08 / 90304ES20 Size 5 μg / 20 μg Components Name 90304ES08 90304ES20 HiActi™ Recombinant Porcine IL-8 Protein, His Tag 5 μg 20 μg Performance parameters Synonyms interleukin 8, IL8, AMCF-I, CXCL8 Species Porcine Expression Sequence MARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ with polyhistidine tag at the C-terminus. Accession P26894 Tag C-His Expression System E.coli Molecular Weight The protein has a calculated MW of 10.04 kDa. The protein migrates about 11 kDa under reducing condition. Purity >98% as determined by SDS-PAGE. Endotoxin Show more