HiActi™ Recombinant Mouse Activin B Protein, His Tag _ 91712ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

Activin B is a cytokine belonging to the transforming growth factor-beta (TGFβ) family. It is a protein with a molecular weight of 12.9 kDa and consists of 116 amino acid residues. Activin B exhibits a wide range of biological functions, including stem cell differentiation, inflammation, bone remodeling, and neurodevelopment. It is also involved in regulating the secretion of follicle-stimulating hormone (FSH). Furthermore, Activin B induces the phosphorylation of Smad proteins and their binding to Smad-binding elements. Specifications Cat.No. 91712ES08 / 91712ES20 / 91712ES60 / 91712ES76 Size 5 μg / 20 μg / 100 μg / 100 μg Components Name 91712ES08 91712ES20 91712ES60 91712ES76 HiActi™ Recombinant Mouse Activin B Protein, His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms Activin Beta B; Activin beta-B chain; INHBB; inhibin beta B Species Mouse Expression Sequence MGLECDGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus. Accession Q04999 Tag C-His Expression System E.coli Molecular Weight The protein has a calculated MW of 13.71 kDa. The protein migrates about 17 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more