HiActi™ Recombinant Mouse IFN-alpha 1a, His Tag _ 91232ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

Interferon alpha-1a (IFN-α1a) is a leukocyte interferon and a variant of interferon-alpha. It is a protein with a molecular weight of 18.4 kDa, consisting of 166 amino acid residue s. IFN-α1a binds to the interferon receptor, thereby activating immune response signal transduction via the JAK/STAT pathway in leukocytes and lymphoblasts. Specifications Cat.No. 91232ES08 / 91232ES20 / 91232ES60 / 91232ES76 Size 5 μg / 20 μg / 100 μg / 100 μg Components Name 91232ES08 91232ES20 91232ES60 91232ES76 HiActi™ Recombinant Mouse IFN-alpha 1a, His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms interferon alpha 1a, Ifa, Ifa8, IFNA Species Mouse Expression Sequence CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK with polyhistidine tag at the N-terminus. Accession P01572 Tag N-His Expression System E.coli Molecular Weight The protein has a calculated MW of 19.93 kDa. The protein migrates as 17-25 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more