HiActi™ Recombinant Mouse IL-28A Protein, His Tag _ 90293ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

The predicted molecular weight of Interleukin-28A (IL-28A) is 22.3 kDa. There are two isoforms of IL-28: IL-28A and IL-28B, which play a role in antiviral immune defense. This incl udes inducing an "antiviral state" by activating Mx proteins, 2',5'-oligoadenylate synthetase, and ISGF3G. Specifications Cat.No. 90293ES08 / 90293ES20 / 90293ES60 / 90293ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 90293ES08 90293ES20 90293ES60 90293ES76 HiActi™ Recombinant Mouse IL-28A Protein, His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms interleukin 28A, IFN-λ2, IL28, IL28A Species Mouse Expression Sequence MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV with polyhistidine tag at the C-terminus. Accession AAX58714.1 Tag C-His Expression System E.coli Molecular Weight The protein has a calculated MW of 20.61 kDa. The protein migrates as 17-25 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more