HiActi™ Recombinant Human Galectin-10 Protein, His Tag _ 92312ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

Galectin-10 (Gal-10) is a member of the galectin family and one of the prototype galectins. It contains a carbohydrate recognition domain (CRD) responsible for binding β-galactosid es, and exists as a biologically active homodimer. Galectin-10 has been reported to be present in eosinophils, as well as in basophils and macrophages. Accumulating evidence indicates that galectin-10 spontaneously forms Charcot-Leyden crystals (CLCs), which are involved in allergic reactions and related inflammatory responses. Multiple binding partners for galectin-10 have been identified, including eosinophil cationic ribonuclease, eosinophil-derived neurotoxin (EDN, RNS2), and eosinophil cationic protein (ECP, RNS3), suggesting that these interactions are crucial for eosinophil differentiation and granule formation. Specifications Cat.No. 92312ES08 / 92312ES20 / 92312ES60 / 92312ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 92312ES08 92312ES20 92312ES60 92312ES76 HiActi™ Recombinant Human Galectin-10 Protein, His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms GAL10, Gal-10, LGALS10, LGALS10A, LPPL_HUMAN Species Human Expression Sequence SLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR with polyhistidine tag at the N-terminus. Accession Q05315 Tag N-His Expression System E.coli Molecular Weight The protein has a calculated MW of 16.31 kDa. The protein migrates as 16-19 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more