HiActi™ Recombinant Human Galectin-14 Protein, His Tag _ 92315ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

Galectin-14 (Gal-14) is a member of the galectin family and one of the prototype galectins. It contains a carbohydrate recognition domain (CRD) responsible for binding β-galactosid es, and exists as a biologically active homodimer. Similar to galectin-13, which is expressed in the placenta and involved in T-cell apoptosis, immune regulation, and immune tolerance, galectin-14 plays a crucial role in fetal development. It enhances trophoblast cell migration and invasion by promoting the expression of MMP-9 and N-cadherin via the Akt pathway. Additionally, galectin-14 stimulates unprimed T cells to produce IL-8, a process associated with angiogenesis at the maternal-fetal interface. Specifications Cat.No. 92315ES08 / 92315ES20 / 92315ES60 / 92315ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 92315ES08 92315ES20 92315ES60 92315ES76 HiActi™ Recombinant Human Galectin-14 Protein, His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms LGALS14, CLC2, PPL13 Species Human Expression Sequence SSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD with polyhistidine tag at the N-terminus. Accession Q8TCE9 Tag N-His Expression System E.coli Molecular Weight The protein has a calculated MW of 16.9 kDa. The protein migrates as 17 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more