HiActi™ Recombinant Human Galectin-13 Protein, His Tag _ 92314ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

Galectin-13 (Gal-13) is a member of the galectin family and one of the prototype galectins. It contains a carbohydrate recognition domain (CRD) responsible for binding β-galactosid es, and exists as a biologically active homodimer. Expressed in the placenta, galectin-13 participates in T-cell apoptosis, immune regulation, and immune tolerance, all of which are crucial for fetal development. For instance, galectin-13 forms crystal-like aggregates in the decidua, which attract and eliminate maternal immune cells. Furthermore, galectin-13 is essential for neutrophil polarization in the placental growth-permissive phenotype. Specifications Cat.No. 92314ES08 / 92314ES20 / 92314ES60 / 92314ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 92314ES08 92314ES20 92314ES60 92314ES76 HiActi™ Recombinant Human Galectin-13 Protein, His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms LGALS13, GAL13, PLAC8, PP13 Species Human Expression Sequence SSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN with polyhistidine tag at the N-terminus. Accession Q9UHV8 Tag N-His Expression System E.coli Molecular Weight The protein has a calculated MW of 16.9 kDa. The protein migrates as 17 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more