HiActi™ Recombinant Human Galectin-12 Protein, His Tag _ 92313ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

Galectin-12 (Gal-12) is a member of the galectin family and belongs to the tandem-repeat-type galectins. Its single polypeptide chain contains two carbohydrate recognition domains (CRDs) connected by a linker region. The CRDs are responsible for β-galactoside binding and are required for interaction with the VPS13C protein. Galectin-12 has been reported to be present in adipose tissue, but it is also expressed in macrophages and other leukocytes. It is involved in various biological activities, including cell cycle regulation, apoptosis, and cell differentiation. Furthermore, galectin-12 has emerged as a key driver of macrophage M1 polarization, thereby promoting inflammation and reducing insulin sensitivity in adipocytes. Specifications Cat.No. 92313ES08 / 92313ES20 / 92313ES60 / 92313ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 92313ES08 92313ES20 92313ES60 92313ES76 HiActi™ Recombinant Human Galectin-12 Protein,His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms LGALS12, GAL12, GRIP1 Species Human Expression Sequence SQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKLALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS with polyhistidine tag at the N-terminus. Accession Q96DT0 Tag N-His Expression System E.coli Molecular Weight The protein has a calculated MW of 38.4 kDa. The protein migrates as 38 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more