HiActi™ Recombinant Human Galectin-16 Protein, His Tag _ 92316ES

Yeasen - Leading Innovation in Molecular Enzymes and Reagents Verified independent store

→

Galectin-16 (Gal-16) is a member of the galectin family and one of the prototype galectins; however, it exists as a monomer and exhibits significant differences from other prototyp e galectins in β-galactoside binding. Like galectin-13 and galectin-14, galectin-16 is expressed in the placenta, where it participates in T-cell apoptosis, immune regulation, and immune tolerance, making it essential for fetal development. The molecular mechanism by which galectin-16 forms a complex with c-Rel has been elucidated, suggesting that galectin-16 activates signal transduction pathways via the c-Rel hub in B cells or T cells at the maternal-fetal interface. Specifications Cat.No. 92316ES08 / 92316ES20 / 92316ES60 / 92316ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 92316ES08 92316ES20 92316ES60 92316ES76 HiActi™ Recombinant Human Galectin-16 Protein,His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms LGALS16 Species Human Expression Sequence SFLTVPYKLPVSLSVGSCVIIKGTLIDSSINEPQLQVDFYTEMNEDSEIAFHLRVHLGRRVVMNSREFGIWMLEENLHYVPFEDGKPFDLRIYVCLNEYEVKVNGEYIYAFVHRIPPSYVKMIQVWRDVSLDSVLVNNGRR with polyhistidine tag at the N-terminus. Accession A8MUM7 Tag N-His Expression System E.coli Molecular Weight The protein has a calculated MW of 17.4 kDa. The protein migrates as 18 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin Show more